9966865

Note: 

This page shows detailed information for a human transmembrane domain sequence. The transmembrane domain has been defined as the first to the last predicted transmembrane helix residue. Modeling coverage, and the location of the predicted transmembrane helices, are summarized in the ModBase Sketch, which also links to the ModBase details. The transmembrane helices were predicted using TMHMM.

GI ID: 

9966865

Uniprot ID: 

Q9HCX4

Annotation: 

RecName: Full=Short transient receptor potential channel 7;Short=TrpC7;AltName: Full=Transient receptor protein 7;Short=TRP-7;Short=hTRP7;

ModBase Sketch: 

ModBaseSketch

Number of predicted TM Helices: 

5

First TMH Residue: 

352

Last TMH Residue: 

670

% Residues Modeled at 100% Sequence Identity: 

0

% Residues Modeled at 95% Sequence Identity: 

0

% Residues Modeled at 90% Sequence Identity: 

0

% Residues Modeled at 30% Sequence Identity: 

18

% Residues Modeled at 25% Sequence Identity: 

18

% Residues Modeled at 20% Sequence Identity: 

18

Sequence ID: 

0d974916f4a95bcc4a5c53e92c6ef74dMLRNGKDI

AA Sequence: 

MLRNSTFKNMQRRHTTLREKGRRQAIRGPAYMFNEKGTSLTPEEERFLDSAEYGNIPVVRKMLEESKTLNFNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVRIVEAILNHPAFAQGQRLTLSPLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIVHILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDVNFQVWSDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSIAVKFLAVFGVSIGLPFLAIAYWIAPCSKLGRTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFEGVKTLPNETFTDYPKQIFRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLSIFVASFTARFMAFLKATEAQLYVDQHVQDDTLHNVSLPPEVAYFTYARDKWWPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYRGAKYNPAFTTVEESFKTLFWSIFGLSEVISVVLKYDHKFIENIGYVLYGVYNVTMVVVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVPSPKSFYYLIMRIKMCLIKLCKSKAKSCENDLEMGMLNSKFKKTRYQAGMRNSENLTANNTLSKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNLNKDHLRVNKGKDI

TMD Sequence ID: 

2d78e0c1c597cb30df6f9d0e8869bee0FLAVMLIA

TMD Sequence: 

FLAVFGVSIGLPFLAIAYWIAPCSKLGRTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFEGVKTLPNETFTDYPKQIFRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLSIFVASFTARFMAFLKATEAQLYVDQHVQDDTLHNVSLPPEVAYFTYARDKWWPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYRGAKYNPAFTTVEESFKTLFWSIFGLSEVISVVLKYDHKFIENIGYVLYGVYNVTMVVVLLNMLIA