![]() PIBASE
|
Queries (detailed) | Introduction | Statistics | Download | related work |
Details of domain BDP21692-0_CATH.1ivoC00Source: This domain is from PIBASE complex 21692, the definition is based on cath ver 3.1.0
Number of chains: 1 Sequence:ECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWESolvent accessible surface area:Total solvent accessible surface area: 3999.72 Ųof which 1692.32 Ų is polar, 2307.37 Ų is nonpolar and 3346.23 Ų is from side chain and 653.46 Ų is from main chain atoms |