![]() PIBASE
|
Queries (detailed) | Introduction | Statistics | Download | related work |
Details of domain BDP21692-0_SCOP.d1ivoa1Source: This domain is from PIBASE complex 21692, the definition is based on scop ver 1.73
Number of chains: 1 Sequence:EEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILH GAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGS Solvent accessible surface area:Total solvent accessible surface area: 8395.12 Ųof which 4845.37 Ų is polar, 3549.76 Ų is nonpolar and 7188.93 Ų is from side chain and 1206.22 Ų is from main chain atoms |