PIBASE
|
Queries (detailed) | Introduction | Statistics | Download | related work |
Details of domain BDP21692-0_SCOP.d1ivoa2Source: This domain is from PIBASE complex 21692, the definition is based on scop ver 1.73
Number of chains: 1 Sequence:VCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKE ISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQ Solvent accessible surface area:Total solvent accessible surface area: 8898.4 Ųof which 4571.13 Ų is polar, 4327.29 Ų is nonpolar and 7483.61 Ų is from side chain and 1414.78 Ų is from main chain atoms |